› › Troponin C, slow skeletal and cardiac muscles

Troponin C, slow skeletal and cardiac muscles in PDB entry 1j1e, assembly 1, front view.
Troponin C, slow skeletal and cardiac muscles in PDB entry 1j1e, assembly 1, side view.
Troponin C, slow skeletal and cardiac muscles in PDB entry 1j1e, assembly 1, top view.
Chains: A, D
Length: 161 amino acids
Theoretical weight: 18.4 KDa
Source organism: Homo sapiens
Expression system: Escherichia coli
UniProt:
  • Canonical: P63316 (Residues: 1-161; Coverage: 100%)
Gene names: TNNC, TNNC1
FASTA Sequence
>pdb|1j1e|A D
MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGSISTKELGKVMRMLGQNPTPEELQEMIDEVDEDGSGTVDFDEFLVMMVRSMKDDSKGKSEEELSDLFRMFDKNADGYIDLEELKIMLQATGETITEDDIEELMKDGDKNNDGRIDYDEFLEFMKGVE
PDBe-KB: UniProt Coverage View: P63316  

Quick links

Search similar proteins